IGF-1LR3/
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK
Sheet
- Molecular Weight
- 9117.5 g/mol
- Molecular Formula
- C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
- CAS
- 946870-92-4
- Assayed Purity
- 99%+
- Standard Vial
- 1mg lyophilized
- Source
- Domestic · 3rd-party verified
- Storage
- -20°C lyophilized
Mechanism
IGF-1 Receptor
PI3K/AKT Signaling Pathway
Recovery Research
IGF-1LR3 is supplied as a lyophilized powder for laboratory research use. Published literature characterizes its interaction with IGF-1 Receptor and PI3K/AKT Signaling Pathway.
Published research demonstrates IGF-1 LR3 modulates targeted signaling cascades within cell tissue models. Identity and purity are verified per lot by HPLC and mass spectrometry at 99%+. For research purposes only. Not for human or animal use.
Questions
IGF-1LR3 is supplied as a lyophilized powder for laboratory research use. Published literature characterizes its interaction with IGF-1 Receptor and PI3K/AKT Signaling Pathway. Referenced for mechanism only; for research purposes only.